DPCstruct | MC4901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1M7Z9 | 15-245 | SKKKSKDGDNDNDKRIRHRIRGISICRSSLNPIPETDKITESSTQKDKSVLESAVFRDETDNAKTSKTPTHDNVRRTGPSSRKDSAF… |
| A0A370U1H2 | 1-190 | MPNDMPPSRSPAPPRSSYMPSRAPQLPAYQPSMPPPINMPTALLRDGPPGEPSKFATALQREGGFATALQRDGGFATTLQRDRQPTI… |
| S3DWW7 | 12-227 | None |
| A0A1L7WES6 | 1-207 | None |
| A0A1L7WCG5 | 333-576 | None |
| A0A2V1BNZ0 | 117-317 | None |
| G2YYR2 | 128-342 | None |
| A0A4Q4X2A1 | 107-300 | None |
| A0A370TCR8 | 323-555 | None |
| A0A2J6PSI8 | 6-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.