DPCstruct | MC49009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 150 ± 29 aa |
| Standard deviation of domain lengths | 28.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 95.01 |
| Assigned Pfam label(s) | CL0007- PF04563- PF00542- PF04561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YKU6 | 9-170 | IFKDWQSDPKKLNEPIKAIEVKGLVKQHIDSYNYFINDEIKKIVKANEKVTSDADPLFYVKYLNVNVGTPDVEEAYNISKSTTPHEC… |
| A0A2G6C6V1 | 3-97 | HQKDSWRNFVEDGLSEIFSEINPIDDYTGQKLALRFGSYRFEDPKTTDQFAKENNLTFEAPLHAMVELTNKVTGEVKEQEIYLGDYP… |
| A0A391NIM4 | 64-241 | None |
| A0A1P8BFS9 | 16-184 | None |
| A0A388KVJ8 | 162-353 | None |
| Q8HTL6 | 81-225 | None |
| A0A6C0JBE8 | 6-132 | None |
| A0A086L503 | 150-300 | None |
| A0A7J7IFM7 | 3-137 | None |
| A0A4Q3JVX5 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.