DPCstruct | MC49008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.75 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0039- CL0340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YIH2 | 92-159 | RLKSLREPSKKMSKSDQDPKSRIELTDTPEAILEKCKKAVTDFTSKVTYDPVNRPGVANLLTIHSLFT |
| A0A833UMV0 | 24-91 | RVMSLTDGLSKMSKSAPSDQSRINLLDSKDEIANKIKRCKTDAFTGLEFDNPERPECNNLLSIYQLMS |
| A0A5S6QL48 | 209-276 | None |
| A0A6A5L2Z3 | 175-256 | None |
| A0A377DC28 | 48-134 | None |
| A0A194VM69 | 736-818 | None |
| W9WXQ4 | 110-191 | None |
| T5A6T9 | 1-80 | None |
| A0A7S1XC53 | 38-123 | None |
| A0A7Y1TWK6 | 17-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.