DPCstruct | MC49006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 350 ± 80 aa |
| Standard deviation of domain lengths | 79.61 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05478 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YHV4 | 85-420 | VLLIWTLLLSGISCGCCGAENRAAPTLLTAVILMSVLSIALWGVALSALLIGGHGEVFICRPLYDEPEYRALTSLVDRPGVLFQNGG… |
| A0A6J8BPZ1 | 11-208 | KLLLQNSSHSLSLKKILRDCEVGKSAYAAFELSNIIDISALTNYSGTLNVESQLDNIDVDLSNLEILTPNLTAQLNDLKLSADINFT… |
| T1KVV9 | 161-543 | None |
| A0A834NBT9 | 66-454 | None |
| A0A556TN07 | 48-479 | None |
| B4H680 | 14-338 | None |
| A0A0Q9XAN9 | 507-932 | None |
| A0A498MS93 | 546-949 | None |
| A0A7R9EDY7 | 352-675 | None |
| A0A6P5U4B5 | 634-1069 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.