DPCstruct | MC49005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.64 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF00082- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3CAX2 | 235-300 | TWRDVQHLIAKTAKIPNPTEPGWNINAAGYHVHHRYGFGLLDAGLMVQQAACFQRAPPQRECTEEI |
| A0A2P8YHT4 | 2-62 | QHIVVRTARPANLKSPDWKVNGVGRNVSHSFGYGLMDAYAMVKLARSWKTVPEQHKCEVSA |
| A0A0V0WHT1 | 51-112 | None |
| A0A7R9QRG9 | 30-91 | None |
| H3CMR1 | 198-259 | None |
| A0A8B6BU46 | 380-447 | None |
| A0A0G2KZR4 | 12-77 | None |
| A0A7M3XJ53 | 30-89 | None |
| A0A0B2VGR5 | 205-277 | None |
| A0A7J8BTA4 | 12-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.