DPCstruct | MC49003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YCK5 | 101-239 | GPLEEMHLLPDPVFVLPTDGVTINTIASTATGRIFLGGRDGCLYEVAYQGACSWFGKRCKKLNHSTGTLSFLVPSFLNMAFSEEDPI… |
| A0A059JD43 | 114-236 | VPIRGLDINVIASSDSTGRIFFAGSSDNDVYELTYQQEERWFQGRCSKVNHTTKSFTAFAPQFNLRNKPTEFVEQMVVDDSRNLLYT… |
| A0A3P7DVV5 | 1-129 | None |
| A0A0M3K8X3 | 236-367 | None |
| A0A7G2C0L5 | 1-134 | None |
| S9TRY2 | 76-218 | None |
| A0A4W3HDG0 | 26-169 | None |
| A0A183I2J2 | 189-318 | None |
| A0A183CX21 | 1-129 | None |
| P38181 | 241-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.