DPCstruct | MC4900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820PN43 | 173-272 | RTAQPPADLLQVNYTLDIQRNRVETVREIKRVMHENNYQRSIAILKAQVDKIKASVSAQDPFCQLLVKDLEYRYPSERDYRTSYYNA… |
| A0A815AVL2 | 128-215 | RDLHPSDDLLHINHVLDIQRNRVETTYALEQAMIEDDYRQSRAILKAQIDKIKASVSVQDLFCQKLIKDLEYHYPTERDYRSSQHNTY |
| A0A814FMU4 | 110-214 | None |
| A0A814Y7I1 | 366-465 | None |
| A0A817TZD6 | 35-156 | None |
| A0A817TUB0 | 137-258 | None |
| A0A818K4Y7 | 11-124 | None |
| A0A818Q5P4 | 264-369 | None |
| A0A819JPK4 | 609-695 | None |
| A0A814SEF1 | 889-985 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.