DPCstruct | MC490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 247 ± 51 aa |
| Standard deviation of domain lengths | 50.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.53 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0123- PF02946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7LXV4 | 252-556 | NSRQPNAYNAWSHHIAKEANEASQASPSNLLNLQQEKIDDYYDLTEEQWEQYVNELVDQRQSQSTSLRTTQRGRTQDVNNICGKIVD… |
| A0A286U957 | 32-283 | SLDEFRHFAEREGRDFLQIRLSAARWHSKFLFEYEKQHNNANESNIQTSVKEQIEDVLTNVSNTLESLCEATSQHSFMLVVDPKDES… |
| A0A485P0Z2 | 25-239 | None |
| A0A2I1EM79 | 527-785 | None |
| E3JUE2 | 125-365 | None |
| A0A5N4CXZ4 | 131-367 | None |
| A0A2N5VIR5 | 124-370 | None |
| A0A2N5VRY6 | 9-215 | None |
| V2WQG4 | 3-270 | None |
| M5FPI1 | 759-1009 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.