DPCstruct | MC49
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0491- PF03194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9UL63 | 1-108 | MAALGSPLRTFHGLLRELRYMNGVTRYRDTAAYKYIREQFRRNQVTEEKLCRAQQELHFQASTYLCLLHSVRNHDMLHQEYHAKGER… |
| A0A671UMJ3 | 1-105 | MATMSSPLRVCRGILKELRVMQGPSYKESLAYSYVMDQFRKNKVTGERYCRAQQEAHHDSHTYLCLLESTRNHLYLHNLYHSKGERS… |
| A0A3Q7QXM4 | 1-129 | None |
| F6PNZ0 | 1-103 | None |
| A0A815SKS2 | 423-532 | None |
| S9Y9S2 | 1-88 | None |
| G4VFF6 | 1-100 | None |
| E1BXK8 | 141-247 | None |
| A0A812CWN8 | 1-107 | None |
| Q8MNU8 | 11-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.