DPCstruct | MC48998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 325 ± 35 aa |
| Standard deviation of domain lengths | 35.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8Y5T8 | 56-378 | FADAVRQLKLCESKLASCETRNTSERSHQQHKIEDAPAVQSELLYMRRFVNILLRTSKLKTDGLPEDLDTTVRISVNLDQLGILQKF… |
| A0A224YTH8 | 103-499 | TTPEARARIYSEIRAQAAAESKKFSRYPAAFEEPDETVVETTNEESETSKEESARSPTGCDGKQGSGCDCDCKAMQREAKKCSEQAK… |
| A0A0X3P541 | 4-294 | None |
| A0A044SLR1 | 45-340 | None |
| A0A4U5LR96 | 2-351 | None |
| A0A0K0EHB1 | 19-333 | None |
| A0A6V7WXB6 | 12-319 | None |
| A0A151X7E7 | 1-309 | None |
| A0A8B6F5R8 | 78-404 | None |
| A0A817WT02 | 16-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.