DPCstruct | MC48995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 182 ± 26 aa |
| Standard deviation of domain lengths | 25.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1GQW7 | 21-189 | SHNMAAMALQKLQSRQLNLCKPIRRPYSCVKSCGEGYEECGSFPHCYNPTVGESCCTNGKYCPKGTFCTDSGCCPEGSSLADCNATE… |
| A0A7C8MQQ2 | 20-190 | VSSSSVVAAQQEFWWSFKPNHTSDEGYDPSFEICGTSCDGCDRSAKQCFSSEFANICYQPDQGESCCKDQYGTACVDGFYCAYNDKA… |
| A0A420Y4A9 | 1-238 | None |
| A0A0F2LRE7 | 191-415 | None |
| A0A6G1FXH5 | 84-244 | None |
| A0A6A5W857 | 34-187 | None |
| A0A6A5U5P8 | 5-190 | None |
| E5QYB5 | 14-171 | None |
| M2V973 | 1-216 | None |
| A0A0J9EKZ2 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.