DPCstruct | MC48994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 55.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177AHI5 | 87-193 | YLVALQSLNSAADSGEKAIMPNECLVLEDSVAGVEAGRRAGMRVVWVPHRDVAVEYQLRQKNVLAGRTGMIELGDDWQLGEIDDGWA… |
| C1GQ20 | 1-98 | MKRLLSFFEPDMTVLVLPNECLILEDKCDRDWMRDFWVPHLDVAVECKTKQKDMLTGRTVMIKVADDRQLGQLDDGWAESIPYLEHF… |
| A0A317SPD6 | 56-168 | None |
| A0A0F0I534 | 172-280 | None |
| A0A2B7Z483 | 690-794 | None |
| A0A507BBV2 | 511-605 | None |
| S7Z7N2 | 82-180 | None |
| E4UUN2 | 119-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.