DPCstruct | MC4899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815UZC6 | 30-138 | RTITNWVGTYNVDDSCNQDECCCLSEQVKISKLSEAELLVSANIVGKTCPSELNGSIEVPIPTPQDKSGFQTTTSFLGTMNRFTLSY… |
| A0A816LGV1 | 4-105 | RSQKWTGVFQADSKCDANACCCITGNKLATNYSTNTLEVVSDMIGLCQGVKILSTTCPYPNDCNDYVTVFNQNVALELNSDSSTIAF… |
| A0A817ZXC6 | 93-247 | None |
| A0A815ZUP3 | 22-128 | None |
| A0A815STE8 | 93-206 | None |
| A0A815LII0 | 16-132 | None |
| A0A813WPV3 | 415-529 | None |
| A0A816ADX0 | 5-96 | None |
| A0A817Q9G5 | 63-183 | None |
| A0A820N0V7 | 12-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.