DPCstruct | MC48984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4GDX6 | 3-63 | RISITVKVFFQDPFWIGLCERTDRRGCSVCKITFGPEPKEYEVQEFISQYWYRLSFSPAVA |
| A0A7W2EAW5 | 20-105 | LPAQFTLFHDGQFWCGVYETSSNNQLRAVRVVFGPEPNNAELYEWLLVNGSSLVKRAHRSVPIPGAIEEPQRGNPKRLQRKVNKEQ |
| A0A0K1PRJ4 | 3-92 | None |
| A0A544YB71 | 70-155 | None |
| A0A413SFQ9 | 7-91 | None |
| A0A1C6GVV1 | 7-91 | None |
| A0A7X8W318 | 1-91 | None |
| A0A3N0AEX1 | 3-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.