DPCstruct | MC4898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818SLU2 | 7-130 | DDTGKDIWSLISLDKLATAISSLGERIDQLKDDSWRLSEKTKSSSSCWSEVINGLKLDDNEKNRHTLYKVWHGNRHKIHALVDEKKS… |
| A0A816L6Z0 | 9-123 | NIDGKNIWSRITLEKLVDAISILGSRSNQLQDEGWQLNIKTRSSNSLWYEVIQALQLDHDEQTRLACYKLWHCNRHVIRELVEEKKK… |
| A0A815KP95 | 16-127 | None |
| A0A815ZU18 | 1-138 | None |
| A0A817W2Z0 | 42-165 | None |
| A0A819XYJ7 | 40-166 | None |
| A0A816TXT6 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.