DPCstruct | MC4897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 58.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816PWU4 | 126-222 | VSPRILRPAMRKDCRHIEERISRVTDTKRTPVDLYKGVQGSTATRETRMEVVAWIAVCKFDCKLEGGFVRDWIVGHYTLRPPGVTDP… |
| A0A816KN85 | 50-158 | TVEPRGLKFSTRQRYPDVEKRIARVTDSKRRIDDLLAAISGPQAARETRMESVAWITVCHFTCCIFGGFARDWIVSGYNSKPATHQH… |
| A0A817V8H5 | 399-505 | None |
| A0A817LHT6 | 8-107 | None |
| A0A817GWD4 | 65-168 | None |
| A0A820PW96 | 1-101 | None |
| A0A820WN16 | 1-120 | None |
| A0A822DBM4 | 58-165 | None |
| A0A814CJW1 | 488-585 | None |
| A0A817QME3 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.