DPCstruct | MC48967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 69 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2PBC7 | 1-62 | MSCTVGNSYIVKAGDTLFIIAQNELGDGNRWREIKKPDGTPFTDADATNLQVGQEICISNGV |
| B2J4Y1 | 1-60 | MSCKIGSSYTIKPNDTLFEIAARELGDGDRWREIMNPNGIPFTEEEAENLQTGQEICLPK |
| A0A0C2VHF5 | 8-72 | None |
| A0A6P2APR7 | 10-97 | None |
| A0A0L6CEN7 | 12-109 | None |
| A0A832GZF3 | 137-200 | None |
| A0A4V1CWI8 | 213-297 | None |
| A0A235HL17 | 1-68 | None |
| A0A523XYK9 | 118-174 | None |
| A0A7C9TZG6 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.