DPCstruct | MC48961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 159 ± 29 aa |
| Standard deviation of domain lengths | 29.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NNF2 | 1-176 | MAGGLAEHGLVCYNWPWKVLMPGKQWPTTTKPKGISDLTLSEHAKLVCSLQDKGLERLYFKAVPKIKGVIYYTVVIVSNMFIAQLIN… |
| A0A0C9Y0L9 | 30-179 | GRLFPWKNLPKSLAKSSIVCYNFPDNILFPGEEQQPRPKSGSKGISDLTLAECRTLIAALTDKSKHGLHFVVKPDAHDALYYSQSPV… |
| A0A0D0CYR1 | 11-140 | None |
| A0A0C9YW48 | 95-228 | None |
| F8NZ09 | 192-394 | None |
| A0A409Y0M4 | 131-327 | None |
| A0A0C2ST01 | 146-303 | None |
| A0A0C3DK33 | 260-375 | None |
| A0A0C3NBU9 | 37-171 | None |
| B8PLI1 | 11-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.