DPCstruct | MC4896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 145 ± 26 aa |
| Standard deviation of domain lengths | 26.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2YI70 | 65-223 | TAASAVKRLARNDPSGRHICYRAYVSGQGWQKPVCDGTMAGTTNQNRPIKALNIAVSGSGGSSANAFVHNSASKDGRGKWMPQWTPV… |
| A0A816KA41 | 3-127 | AHIQNIGWASNYRLGQVVGTEGIKSRLEAYRINSNPYTPSITYRSHVQKIGWQNYVHTNDISGTTGRSLRLEALQINIGSNIGGKVY… |
| A0A1Q6L4J1 | 351-519 | None |
| A0A6L7ABI5 | 134-282 | None |
| A0A5Q2RLK1 | 244-399 | None |
| A0A1Q6LII8 | 181-309 | None |
| A0A2Z4I4Z6 | 17-186 | None |
| A0A2Z4ICH9 | 114-261 | None |
| A0A2Z4ICK8 | 465-608 | None |
| D9STN7 | 82-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.