DPCstruct | MC48958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 20.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YH42 | 1-120 | MAAAINQACVWVELAYTKLQNTEALAAHIQGQLGLKSPWKVGCEEYNRYREEAMLGKYHKALGELEWLVVMRLFELSKLAMSGTGYK… |
| F8ND01 | 11-131 | MEKLKAVQALELKLTIDKQWTPEGAESQSTTRIIAMRDYQRALDHLEGLIVVRIFELSKMNRSQTGYALRKHIGKALQARSATIRTA… |
| A0A6A4GX00 | 515-645 | None |
| A0A2H3CND8 | 160-293 | None |
| A0A1J8PS06 | 210-351 | None |
| F8NDP7 | 97-250 | None |
| F8P3P6 | 139-263 | None |
| V2W851 | 72-202 | None |
| V2WQD7 | 39-146 | None |
| A0A0D0CYL9 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.