DPCstruct | MC48953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 455 |
|---|---|
| Mean domain length (aa) | 214 ± 43 aa |
| Standard deviation of domain lengths | 43.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 93.98 |
| Assigned Pfam label(s) | CL0023- CL0264- CL0187- PF11860- CL0155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2LA92 | 5-168 | FANTGSDTVKKQEAAAFLANVSHETGGLVYVVEQNTANYPHYCDSSQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLHNP… |
| A0A4U1BMN7 | 68-287 | RPSVSSSDFVELTPPLLMRAVPKLRSQRVDDLCAALNEVLPRYQIVGTRRQAHFLAQVGHESMSFLATTENLNYSATALQSTFGKYF… |
| A0A1E7I3P6 | 103-367 | None |
| A0A158BUG6 | 81-274 | None |
| A0A2E4QVS9 | 85-292 | None |
| A0A557QLR5 | 9-192 | None |
| A0A423ES90 | 470-698 | None |
| A0A418WDB1 | 193-382 | None |
| N4X903 | 12-252 | None |
| F4PK72 | 622-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.