DPCstruct | MC48952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 181 ± 32 aa |
| Standard deviation of domain lengths | 31.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.64 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF20039- CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A530B389 | 2-183 | TQVADNIKAQGRANIVAAGFSKRWANAFRVNVYPKGQFSAEPAALVYHKVPYADVFETGAMIQGSPFLWLPLPDAPKGRGNRRISAG… |
| A0A4U1BLW6 | 17-224 | AEVASTLTDLQRKSIPKATRQGLNRAITSTRGTAVKIISEETGIKQKDVRAELRVSKATSKQKTPSAEIKVYRRTKAINLIEFVTPN… |
| A0A7C1N324 | 21-253 | None |
| A0A1F8ZNT5 | 4-143 | None |
| A0A521VMC2 | 154-341 | None |
| A0A7Z0GDX1 | 2-206 | None |
| A0A3E1EBK4 | 12-224 | None |
| A0A2G2LFW1 | 87-288 | None |
| A0A1W1CCF1 | 9-145 | None |
| A0A2X5NNS1 | 128-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.