DPCstruct | MC4895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 74.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816GYE3 | 1-69 | VMDLCRSILISSRIFSFGLDHSPSRSLIRGLARSTNGRFTFIPLGTGADIHVAEHLQKALESCITDVKV |
| A0A822BP09 | 197-255 | IELCHSMSSTTRIFTFGLGHSPSRSLVKGLARATNGHFVFIPPGEKVDTYVGSQLRRAL |
| A0A818FX28 | 287-354 | None |
| A0A815K8K2 | 1-68 | None |
| A0A820VM44 | 35-101 | None |
| A0A819P9U4 | 148-214 | None |
| A0A815PYU9 | 96-164 | None |
| A0A817BQE0 | 1-59 | None |
| A0A817VCH3 | 2-67 | None |
| A0A817DU70 | 449-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.