DPCstruct | MC48949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 23.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.93 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0229- CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1N360 | 11-142 | LVSSPALMAALLAFTYTTGKLDWTRVVGSGGMPSSHTSLVVGLATAVGLKESLDSSLFALCLVFSLVVMYDATGVRLHAGRQAEVLN… |
| A0A0J1DND3 | 2-130 | SSLVAWAIAQGLKLITWAVAAREWNFKRLVEPGGMPSSHSAFVTSLSTAVGLSMGFDSVMFALAAAFAVVVMYDASGVRRAAGKQAK… |
| A0A6A3BFS3 | 34-207 | None |
| A0A7J7Q840 | 4-102 | None |
| A0A354CX07 | 44-193 | None |
| A0A6A6KW25 | 15-121 | None |
| A0A803QJQ3 | 25-155 | None |
| A0A7T9FFV0 | 3-144 | None |
| A0A359MYR2 | 6-142 | None |
| D7CKU8 | 8-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.