DPCstruct | MC48946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Standard deviation of domain lengths | 19.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1MHU3 | 45-178 | DDDADDASDEKTRTSVDTELSNRWIDLDPAGYFLVKVDHATRTIEAAHFENAIDDAGRACDPVTGEVIPCDGSYRKPAASATFAGRT… |
| A0A7J2REQ5 | 1-81 | MPDEKGYFKIYVNHYSEKIYILFFSNHHELIGTIVGTNAEALGKKIIELKLTQNLQHINYIGRELTKAEFCLFSGKPYIQD |
| A0A521S0W3 | 174-287 | None |
| A0A7J3F2C5 | 23-130 | None |
| A0A1C9C7K0 | 5-104 | None |
| A0A533VXH2 | 323-411 | None |
| A0A7S2KQL5 | 22-159 | None |
| A0A1F6QDD5 | 8-100 | None |
| A0A0U5ILV6 | 156-260 | None |
| A0A7C2R0N6 | 68-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.