DPCstruct | MC48942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5TQB1 | 115-221 | TPFVAVGYDYNTGEEDTTKFSSVTLPNNGDGIFDIYLYNGSSFYLAQKDILAGTTYNFKPGGVSRFRILGITPDTKLNSTSSSNFIT… |
| A0A2H6KYC5 | 220-329 | VAVGYNYIVDSGPNMTSVLLPTGIGDGFYELWSDSSGGNCTDFVSSGTTLTGGTTFNFASPLRCFSVRGIETSAGLDPTNPLAFVTG… |
| A0A0B3YAS4 | 289-405 | None |
| A0A5K7YVH1 | 174-289 | None |
| A0A3B0V0N6 | 373-508 | None |
| A0A3S0CSS1 | 162-279 | None |
| A0A3S0BSX2 | 299-426 | None |
| A0A2D6RGI3 | 347-464 | None |
| A0A2P5N027 | 257-369 | None |
| A0A3D4RVZ3 | 15-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.