DPCstruct | MC4894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818MSM1 | 1-146 | MMVIAAQNDVDIKIVDDVNYQPTDEDQARGTNIIVYSKGEKDDQGNFSVGHFQLMTGDGTLVDIQSEKNNCGYSVIQKILKDRSIDK… |
| A0A816GS89 | 1-151 | MMGMAADYGLDMKIVDDKNYQPTEEDKAKGTNIIVFTHGTSDEQGKIGIGHFQLKLPDGEVIDLPGERNNCGYCVFQKILRDRGIEK… |
| A0A7R9AF67 | 353-511 | None |
| A0A816AZZ9 | 318-450 | None |
| A0A820WGT4 | 67-199 | None |
| A0A819R9M9 | 535-672 | None |
| A0A817PSC8 | 489-635 | None |
| A0A819Z911 | 100-236 | None |
| A0A819SLZ7 | 45-219 | None |
| A0A821C512 | 307-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.