DPCstruct | MC48936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 185 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7GE49 | 1-178 | MLALSGCLIVPFAPTAAAFETSTHAAINQGAARASTLDGVLKDELGFLSGLITPLIDRRTPIDWIGLGGLAEDHYLGSEILGSLTRS… |
| A0A1V4XJF3 | 21-198 | FAHENRIVHPMITRNAAQASLTFLSYLSTNPDFNGLDTYLLGKSILNWLRDGSAIEDEPMCRSVNHFHNPLLSWNMSGMSDAPWFIN… |
| A0A5K7YVZ6 | 11-227 | None |
| A0A661SME8 | 18-206 | None |
| A0A445MYA2 | 4-186 | None |
| A0A419IVH5 | 21-212 | None |
| A0A5S9NVK2 | 19-227 | None |
| A0A1F6PFJ5 | 6-167 | None |
| A0A1B4XEW0 | 22-177 | None |
| A0A521SS33 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.