DPCstruct | MC4893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 22.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8F5L6 | 50-181 | QLLMACLLRRFGFVPDCAGVKDMCPVWIHCTAGMMVMLPCASQRLVPRRYGTLIDKSRRFLQQATAGPAGTNLARVEGVPVGFIWSW… |
| A0A816GK84 | 28-156 | DIFQELILKRYGFILNACVSRKDENIYYVHISGGMLVYIISDVYNVHYNSQPTRVITSGLTVDSHSSHLDCGFYWCWNFCLGKKWRS… |
| A0A195AUE7 | 395-582 | None |
| A7S344 | 430-596 | None |
| A0A815K0S6 | 212-376 | None |
| A0A819U078 | 5-107 | None |
| U3IIE0 | 736-870 | None |
| A0A1B0AVM3 | 131-315 | None |
| T1GZQ3 | 188-333 | None |
| A0A0G2K6M8 | 1427-1581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.