DPCstruct | MC48919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 177 ± 45 aa |
| Standard deviation of domain lengths | 44.86 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7AR61 | 18-187 | GMFIARVSRGRTVREFIVAVLLVPTIVSLVWMAIFGGSALDQSANGIGALANGISDSSLAMFQMFANLPMTSVISFIGIILVLVFFV… |
| A0A845ELV2 | 16-160 | LWGSLGSWIYFGVFGGYGMNLELTGEVPLTKILSEQGGPAVIVAVLNSLPLPVIVSAFFVILGFIFLATSLDSASYVIASVATKELG… |
| A0A7W7L2F8 | 34-241 | None |
| A0A2M9AJI4 | 234-511 | None |
| A0A855HUR3 | 52-269 | None |
| A0A7V6GCL0 | 2-122 | None |
| A0A0X2NJU5 | 2-161 | None |
| A0A6B8TM20 | 196-364 | None |
| A0A7W3R481 | 52-257 | None |
| A0A850QMT7 | 14-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.