DPCstruct | MC48910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 211 ± 56 aa |
| Standard deviation of domain lengths | 55.74 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 73.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 73.08 |
| Assigned Pfam label(s) | PF03907- PF09771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W4ZUX8 | 14-195 | SVLFIYHNLLMFEESLRQEYISLYLRRRKYSKVFFLWLLSWIVYFFYGVFIVPSNYYYVSLLYRLCLLAGVITLLLFYLSGLYSKTL… |
| I1C1C5 | 2-155 | DPTEENEPRQNQATYRDLVIFEERLKGNMTRLLKRKRKYEALLVGLFVFLAYFFYAVFIDPSKIFTVHLTNTIALLTVAGGLVFFYR… |
| B6K5G5 | 1-184 | None |
| A0A7M5WTB3 | 4-137 | None |
| A0A0F7RVA7 | 8-195 | None |
| A0A1S8W1H2 | 2-149 | None |
| A0A0C9UFJ8 | 4-240 | None |
| Q9USQ0 | 1-168 | None |
| A0A1Y2GH91 | 13-202 | None |
| A0A427XTS0 | 47-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.