DPCstruct | MC4891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6NLJ0 | 44-147 | AATPVLRGFLADTDVRWNVIAASVDDRTPAERAGGVITKSRYDSIDCYISPRVDLKPEVYNDIPVALNEKVYTRLVDAGIDERLAEH… |
| A0A0S7GU53 | 5-111 | AASPFYRGYMSDIDCRWGVISASVDDRTQEERGLKPLKNNKYRIFKSRYDSIDSYLSCCGEKYNDIDLTIDEEINKQLLGAGIDKLL… |
| A0A7J6LVG2 | 11-117 | None |
| A0A1J8Q9X5 | 119-229 | None |
| A0A2V2VQW3 | 89-189 | None |
| A0A1R0H001 | 131-241 | None |
| A0A1J8QCX6 | 1-110 | None |
| A0A815FFZ9 | 74-185 | None |
| A0A818Q0Z2 | 135-238 | None |
| A0A183D766 | 110-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.