DPCstruct | MC48908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 282 ± 26 aa |
| Standard deviation of domain lengths | 26.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 64.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 33.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6T474 | 1-283 | MLRLSESTDIVGITIRCLKLLVTPHFRSTAEAATRELANLPTQDFSWVPYADSTHKEHWNSIHRDTSQWFRPDPFCCNHHHEPCSKH… |
| A0A6G1ENB3 | 382-638 | LLLYNNHEMPEKNFVLGILLRVTASTNVTGIVVRCLELLPTHFKPVAEAAMQELTQVHQRGFYCFPYVDSTDPRYWRIHHSETHRAR… |
| J3LX61 | 21-334 | None |
| A0A3L6PU36 | 6-248 | None |
| A0A3L6PQV9 | 365-665 | None |
| A0A0D9WV09 | 617-881 | None |
| A0A835F5W7 | 935-1242 | None |
| A0A0D3GLR3 | 247-536 | None |
| A0A0E0LGI7 | 243-548 | None |
| A0A811RZZ8 | 25-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.