DPCstruct | MC48900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381KN07 | 1-101 | MIDIHKNIYDNKLFEELKIDCKKCFGLCCVALYFSASDGFPIDKESGKPCINLQLDFKCSVHNSLMKRGFKGCTAYDCFGSGQKVAQ… |
| A0A438AKJ4 | 35-131 | EFRGDCAACADLCCLALALDRGDAFAIDKPAGQPCPNLAPGGGCTIHATRARAGFPGCVAYDCAGAGQKVTAEVFGGADWRETPALT… |
| A0A2R4M7V7 | 7-90 | None |
| R6G1P3 | 15-100 | None |
| A0A178HTY4 | 2-92 | None |
| A0A413LRL8 | 31-112 | None |
| A0A810LM22 | 8-92 | None |
| A0A2P9HZA1 | 20-117 | None |
| A0A367EV57 | 4-77 | None |
| A0A6A0CEC1 | 94-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.