DPCstruct | MC489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 270 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J6UD72 | 1-261 | MAGKLNLVGEFHSESDARRDEEKRFCLAKVHRPDYWVEHQFPDVYEGGQLANLPGAGEADLMEYRGAHGVAMAIEKFEKLGNDAVNV… |
| A0A1H8E3N8 | 176-435 | QTPEPVPQQTAPEIVPVDDGPVLNALKTRNVILAGETHGMEGVEGKEKQVWGEKGIQVVYENGVIKTGEGAVSPDPGALRILYFMEQ… |
| A0A1Q3GLV5 | 1-326 | None |
| A0A368YE34 | 125-374 | None |
| A0A0U3N4C8 | 72-326 | None |
| A0A349E127 | 285-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.