DPCstruct | MC48899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0341- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381I7T1 | 2-79 | KNIDYMEKYSPNCWMLNYSNPASIIAEAVRRLRPNSRVINICDMPIGMEHNIARIAGLKSRKHMDIRYFGLNHFGLVY |
| A0A381IEM2 | 2-86 | LKKDYWILNYSNPAAIVSEACRKLRPNARIINICDMPIAIIDMIAGSLNINDVHNIRYDYFGLNHFGWFTSIDYKHRDLMEEIKE |
| A0A377XTF4 | 128-217 | None |
| A0A7C3XL08 | 111-207 | None |
| A0A447RXA9 | 7-96 | None |
| A0A0B4N026 | 115-211 | None |
| A0A1V5FCB8 | 1-107 | None |
| A0A0K2REI7 | 73-172 | None |
| A0A398CTG5 | 123-224 | None |
| A0A381KJ58 | 654-749 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.