DPCstruct | MC48898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 88.46 |
| Assigned Pfam label(s) | CL0166- PF03123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381ICZ8 | 1-66 | MRVVKIFNNNALSTVTNDRKEAILLGLGIGFNKRPGDKVNEDKIEKIYYVQDHMQTKFLELLKNVS |
| U5PFJ4 | 2-50 | YRILNPLNHNVALVRNDKGEELIVIGKGIVFGKKKGDLVPKEKVEKLQV |
| A0A2N6SPK0 | 1-74 | None |
| A0A375I1N7 | 1-51 | None |
| A0A6B9I1B9 | 1-74 | None |
| A0A7U9R8D9 | 1-78 | None |
| A0A0R1QEN1 | 1-54 | None |
| D7UWU4 | 5-79 | None |
| A0A1H8BAK2 | 1-75 | None |
| R6QN42 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.