DPCstruct | MC48895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 2.61 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 56.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7D7I5 | 1-66 | MQFVRKISGSTKPSKANDEAFNRAVEEIAHISRHLLQDLVTTAPPKNREVEAEKAKERSAKRFAVA |
| A0A520PPC3 | 21-91 | YASALQYVRKVSGMRKPSKQNEDCFQRAIDEITEITKRLLLEELETSAPSRDREEEKARAKERGQQREARM |
| A0A7V9QKW3 | 21-87 | None |
| A0A5C6TN09 | 95-162 | None |
| A0A849ICC4 | 57-123 | None |
| A0A4R1FDU5 | 38-109 | None |
| A0A192LR10 | 20-82 | None |
| A0A2U1F7J4 | 99-166 | None |
| A0A0A0JNU0 | 7-70 | None |
| A0A1C3YBY4 | 149-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.