DPCstruct | MC48894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 260 ± 46 aa |
| Standard deviation of domain lengths | 46.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378I5C3 | 6-274 | IDYVLVYIGNDLSLWQKNNENQYKKIKNATTPAAQGQYTRLKQISHIPLTIQALIKNYRKSDETEEKFVNQLSQMHAKLNTILASIE… |
| A0A3S0LCY0 | 60-326 | EVNQQLLTNYSAAKNELRKKLGAIVICMDNSLTLIRDGKRESIPFIKPHYTGLKEVAHITLGTFVLLVNHTDEELSESSIAKLKEYR… |
| V5DXK6 | 62-356 | None |
| W0BCE2 | 10-300 | None |
| A0A814VB21 | 19-208 | None |
| A0A0W0VEY3 | 2-209 | None |
| A0A815RV19 | 16-282 | None |
| A0A815RDF4 | 1-227 | None |
| A0A817DIZ3 | 2-150 | None |
| A0A226DF66 | 145-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.