DPCstruct | MC48891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 63.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183SNA6 | 2-65 | QTFAPAIRTFTATPTTINDILPASTDFSCPHCARNFNSRIGLIGHLRIHRTEAGEPVPVAPTYS |
| A0A654GUC0 | 1-86 | MGLFGHMRVHEGGNDRPPDSLTTPNPTLASSPCAPTTLSANDTDFTCPHCPRTFTSRIGLVGHLRIHRTETGESVPGAHYARLNCP |
| A0A183T649 | 1-89 | None |
| A0A183T4P7 | 1-75 | None |
| A0A183T1W4 | 173-254 | None |
| A0A183TQE8 | 1-76 | None |
| A0A654HB86 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.