DPCstruct | MC48890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 163 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 96.02 |
| Assigned Pfam label(s) | CL0412- CL0361- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183SFC6 | 1-143 | MVVFVCGKCNESIKKKNVEQHFNNCRNSTVSCVDCSKDFTYSFASHTSCITEQEKYDKPNFAQKVPKGASKQMEWTEQVHSRLSNFP… |
| A0A0N4ZX17 | 1-152 | MVFFACDNCGESLKKNAVEKHFYRCKNATYSCMDCQVSFDKISYATHLKCVSEQQRYGGSNFVSKENKGEIKQNAWCEQVSKAIENV… |
| A0A7I4DF49 | 85-270 | None |
| F4Q7L8 | 1-142 | None |
| A0A158R4X6 | 389-558 | None |
| A0A0K0EFV8 | 256-477 | None |
| A0A1Y1W6H9 | 1-125 | None |
| A0A0F7SUN7 | 1-177 | None |
| A0A2S7Y8W6 | 321-459 | None |
| A0A044UVV8 | 540-740 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.