DPCstruct | MC48879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 28.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FYM5 | 2-116 | VAMEIIDEMALGLCFEIHRSCKRGLLFLDEMDAESQKLYEIVNIRGVDVFGQTFSAKKQYDCICPNCHRNLAASRFAPHLEKCMGMG… |
| Q5FC18 | 2-98 | QPASLAGISCTIFENLLKDYTHELTQTVHKNAKLSLQKCPACNKHCRQYCTKPGYDIYGNSVQTPSNVPYYSCLMCKREIAASRYAA… |
| T1FN97 | 1-176 | None |
| A0A5D2UU52 | 1-136 | None |
| A0A5D3BBT0 | 252-366 | None |
| R7QND3 | 112-318 | None |
| A0A654HWH0 | 3-148 | None |
| A0A2J8AH53 | 42-159 | None |
| A0A3B5R668 | 11-163 | None |
| A0A4Y2CET0 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.