DPCstruct | MC48877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 133 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7QRV0 | 289-422 | ELVRQCLVALEECVLRFPQHYKSLYRLTHFYFHSKFHRNISKCQDLLMGTYKCLPMEGRPANASFQGLFAERKNNNFFNGVWRIPVS… |
| A0A401PIT8 | 232-360 | LTEQCIRALHLCLSRFPQHYKSLYRLAYLYIYSKTHKNLNWARDVLLGVSIPWQQLKHMPAQGLFYERNKTNFFNGIWRIPVDEIDR… |
| A0A7E4S086 | 1-124 | None |
| A0A023EU54 | 32-171 | None |
| A0A1A9VR68 | 54-206 | None |
| A0A182SQ67 | 930-1050 | None |
| A0A7F5RL70 | 133-261 | None |
| A0A067QER2 | 27-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.