DPCstruct | MC48874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 197 ± 38 aa |
| Standard deviation of domain lengths | 38.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FWZ8 | 1-187 | MPLVKRSIEPSAISHGAIGSDVRNELECVSNNTLSKIIKQLGSLSKQSEDLFAELYVETCTLANRTTNLGRRIDGLKQKICQLNPIV… |
| A0A7J5ZYP9 | 2-127 | GKHAEDIFGELFHEANAFYLRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMRKAFKSSTVQDQQVVSKSSVPIPVKEMHGLSDPP… |
| H2N8D0 | 1-223 | None |
| A0A2I4CBT7 | 1-235 | None |
| A0A2G3D5E8 | 1-249 | None |
| A0A2W1BKY3 | 7-146 | None |
| A0A3Q1GIV8 | 1-228 | None |
| A0A1J3JFX4 | 1-227 | None |
| A0A2P6MUS1 | 15-225 | None |
| A0A0V1D522 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.