DPCstruct | MC48870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 226 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FLR0 | 1-216 | MASITSKLYFHIIKRNNDEFELAGISENKETWYVLPEEMKDLSLHETLSTKRAIINTINSIKRINGYRKICIKLDDELRKEYYDEDE… |
| A0A4C1TTJ0 | 3-181 | KLRFDFAVKTSVDGKSNIVCITSIGTPDGHIFAIPVEYQPASLHQAVTSTSNYIKVKKTLNKRHQTRKIWIALTDEISKTYLDEAQN… |
| A0A6H5HQP7 | 5-248 | None |
| A0A6H5IEY7 | 24-249 | None |
| A0A6H5HRD6 | 1-245 | None |
| J9KFL5 | 2-227 | None |
| A0A6A4K9S3 | 1-214 | None |
| A0A6A4JJU6 | 1-214 | None |
| A0A4C1VPR4 | 2-252 | None |
| A0A4C1U3H2 | 1-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.