DPCstruct | MC4887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 356 ± 49 aa |
| Standard deviation of domain lengths | 48.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C1BUQ8 | 185-576 | APRTRCLHPLAETETMRFDAGHPALLAQQALLDLITTGVGAFGVYARDPQPAMAVLADMRGIARRVLIHMPAPRMKGLVPEELVDAH… |
| A0A1A0WWV2 | 53-397 | EFRRVAPEIVEAQVWILELARGASEPSTNSFGGQRFSTREYFDAALTLGKPIMSCQAASDPDAACLEQLLKVKSILCEEDVHAAHSL… |
| A0A345JV36 | 23-300 | None |
| A0A6L8NAZ7 | 53-496 | None |
| A0A270QMU4 | 184-584 | None |
| A0A6J6XV21 | 30-340 | None |
| A0A553ABS3 | 313-683 | None |
| A0A100Z938 | 1-252 | None |
| J9WC96 | 97-451 | None |
| A0A4U0H391 | 210-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.