DPCstruct | MC48868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673I7L1 | 159-272 | FSQETYIQITQLLDLCILDINSLDFKYGVLAAAAFCHFMSADVVQKVSGLKWEAIETCVNWMAPFVETMMCYESAQLREFGQVPSED… |
| T1FJT8 | 2-131 | GVFLQIEAYKAEEDFFVPQYNQNVFVRASQLLDLCLMSTESLQFGYHLLAATTISFYVKSIITVTQITALSSEEMESCRNWMVPFLD… |
| A0A177B3D6 | 2-134 | None |
| A0A836D2X6 | 128-246 | None |
| A0A4Y2FXA1 | 3-107 | None |
| A0A6V7W4J5 | 112-261 | None |
| G5C4B8 | 52-172 | None |
| A0A444TZX4 | 823-944 | None |
| A0A4Z2CCV2 | 172-297 | None |
| A0A402EH46 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.