DPCstruct | MC48865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1ERX5 | 211-293 | QRGVSTYSHCRNRNKGNYEITANCPDGCDPGWRGDSCRERDCSSGGGDCPVGMECIESTVNGNKYVECVCPPGKVRNKWYQCE |
| T1FC56 | 362-438 | YNYCMNDKIEIKKAYCRTGHCRIGWTGALCDKRDCGVNNGDCGKEMMCVQEIVNNIMFEKCLCGKGFVTTIESQCKK |
| T1FC78 | 233-319 | None |
| T1FLB6 | 14-88 | None |
| T1FFX2 | 4-72 | None |
| T1FC72 | 123-205 | None |
| T1FAH2 | 159-234 | None |
| T1ERU9 | 109-187 | None |
| T1FC60 | 215-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.