DPCstruct | MC48864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 19.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D4RVR6 | 1-134 | MERTDIEFYPFTKEQLKLAANPRYVEKTPAVKQLSEFFRILYEMKKEELDETLNMIVGMMRVDIKFQFIMDELGESIELPAGEEMTI… |
| A0A5D0MIN7 | 72-198 | FDEFDMLLGKKAGKPYYVPDKEKLLKYTNEFYFEKNEQFKELVNYVKDEFFEGDIRDAEDFCAEIQLICQDGFDLKTVMHNFERMDI… |
| R6FIN4 | 178-336 | None |
| A0A7C6UWE6 | 90-248 | None |
| A0A356AZU1 | 108-267 | None |
| A0A355JET2 | 215-370 | None |
| A0A416J4P1 | 1-187 | None |
| A0A1Y3TFD9 | 14-216 | None |
| A0A0F2PY05 | 285-447 | None |
| A0A4Q2LPQ9 | 218-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.