DPCstruct | MC48862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1P604 | 2-87 | IRGLPARILWRLLPARETTGRSEFTNRELGLDKSLNLPEWKDNLESRLLLLRRRLEQKSLTIRLVPRSRGRFVLEVAGTLKLVAQS |
| A0A4Z0BQF0 | 64-164 | RRFPRNDVIFVNGEYLIKGLAGVIFWKVIQDYHRLGRTEFSNLELRLELSQTHPEKAENLESRLVMLIRRLADFKDLRIERIARGKI… |
| A0A7T9E5A9 | 309-408 | None |
| A0A1M3NHV4 | 371-470 | None |
| A0A7X7DK30 | 156-263 | None |
| A0A7X7S060 | 244-343 | None |
| A0A847NYA7 | 350-449 | None |
| A0A1I4L5L4 | 25-129 | None |
| A0A316FYQ1 | 9-74 | None |
| A0A0T6XSF0 | 163-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.